show cdp neighbors on meraki

От:

"event" : "MessagesWidgetCommentForm", { } { "action" : "rerender" "useSubjectIcons" : "true", The domain name that you get in show cdp nei detail" command is VTP domain name of the adjacent switch. }); "event" : "QuickReply", ] } { ] "action" : "rerender" Here is the output after running the command on our router: "disableLabelLinks" : "false", "parameters" : { "actions" : [ { That does not help. { "event" : "MessagesWidgetEditAnswerForm", "context" : "envParam:selectedMessage", "event" : "MessagesWidgetEditAction", "actions" : [ } This script works well, a bit to well. "initiatorDataMatcher" : "data-lia-kudos-id" /meraki configure-basic-access-port [org-name] [device-name] [port-number] [enabled] [vlan] [port-desc]: Configure an access port with description, VLAN and state. } ] To troubleshoot PoE on switches, it is important to rule out any physical layer issues. ] { }, } ], This frame is being multicast in every 60 seconds. ] "context" : "", { Dragging the columns to re-order them; Adding/removing columns using the button; Export the neighbor table by Clicking the button to copy tab-seperated data (ready to paste into a spreadsheet) to your clipboard . LITHIUM.AjaxSupport.ComponentEvents.set({ } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/security/message-id/7046/thread-id/7046","ajaxErrorEventName":"LITHIUM:ajaxError","token":"KJBDkliP-zcxxmjsg3-Dg4dR091LUa0tn5fydeORaHI. } { }, } ] "actions" : [ "parameters" : { "eventActions" : [ "event" : "deleteMessage", "context" : "lia-deleted-state", }, ] } LITHIUM.AjaxSupport.fromLink('#kudoEntity_6', 'kudoEntity', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {}, 'ReOKdIXsf1jjg9mokC-7c1f5cQr6-ShTszAQmXXktWY. "action" : "rerender" { "action" : "rerender" "event" : "approveMessage", ] { }, } // console.log('Welcome to safarithe new internet explorer'); "action" : "rerender" { } Authority. "actions" : [ { }, "actions" : [ ] Examples. "quiltName" : "ForumMessage", "action" : "rerender" "actions" : [ "context" : "", "action" : "pulsate" ] { "action" : "rerender" LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown","menuItemsSelector":".lia-menu-dropdown-items"}}); "actions" : [ } ] "truncateBody" : "true", Output will look similar to this (Output is from a 9800CL) I didn't realize how clean the 9800 AP CDP command would look like. "event" : "ProductAnswerComment", } }, "componentId" : "kudos.widget.button", "action" : "pulsate" "disableKudosForAnonUser" : "false", } "eventActions" : [ "event" : "AcceptSolutionAction", "action" : "rerender" { ', 'ajax');","content":"Turn off suggestions"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_10f452b179b055d","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/security/message-id/7046/thread-id/7046&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); { "event" : "MessagesWidgetAnswerForm", Link Layer Discovery Protocol (LLDP) is a layer 2 protocol used to provide automatic discovery of connected devices and their capabilities. { } } "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", } "initiatorBinding" : true, }, LITHIUM.AjaxSupport.ComponentEvents.set({ ] ] "event" : "MessagesWidgetAnswerForm", "action" : "rerender" }, { the catalyst switch shows mac addresses of the neighboring switches in Sh cdp neighbors. { } "}); "actions" : [ "action" : "rerender" ] { "truncateBody" : "true", { "context" : "", } ], "event" : "removeMessageUserEmailSubscription", ', 'ajax'); }, } ] We could use the command "show cdp neighbor" to find if this port is connected to another switch. "event" : "MessagesWidgetMessageEdit", { } "initiatorDataMatcher" : "data-lia-message-uid" "context" : "envParam:quiltName", "context" : "envParam:quiltName,expandedQuiltName", { "actions" : [ "context" : "", "action" : "rerender" "context" : "", "componentId" : "forums.widget.message-view", "action" : "rerender" "action" : "rerender" "event" : "addMessageUserEmailSubscription", }, "context" : "envParam:feedbackData", "context" : "", Format: member/slot/port. "linkDisabled" : "false" ] ] } { { }, { "event" : "MessagesWidgetEditAnswerForm", }, { { }, } ', 'ajax');","content":"Turn off suggestions"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_10f452b179b055d_0","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.messagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/security/message-id/7046/thread-id/7046&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "disableLinks" : "false", } }, }, "event" : "ProductAnswerComment", While certainly the dashboard ought to expose the LLDP/CDP data, you can get at it via API. "action" : "pulsate" "parameters" : { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } "context" : "", "context" : "", "event" : "MessagesWidgetCommentForm", } LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"threadeddetaildisplaymessageviewwrapper_0","componentSelector":"#threadeddetaildisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":29618,"confimationText":"You have other message editors open and your data inside of them might be lost. { "event" : "MessagesWidgetMessageEdit", }); } "event" : "editProductMessage", "action" : "rerender" "event" : "MessagesWidgetCommentForm", } "event" : "addThreadUserEmailSubscription", "parameters" : { }, { "event" : "addThreadUserEmailSubscription", "}); "actions" : [ { Network management. "actions" : [ "disableKudosForAnonUser" : "false", }, config. "actions" : [ } }); "initiatorDataMatcher" : "data-lia-kudos-id" "actions" : [ "actions" : [ "event" : "removeMessageUserEmailSubscription", "includeRepliesModerationState" : "true", "truncateBodyRetainsHtml" : "false", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#threadeddetaildisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#threadeddetaildisplaymessageviewwrapper_1","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.threadeddetaildisplay.threadeddetailmessagelist.threadeddetaildisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/security/message-id/7046/thread-id/7046","ajaxErrorEventName":"LITHIUM:ajaxError","token":"8Jxq_lCUhGflLNXuUZOextFQMwPJmDYk_InYGhxLIlo. ] "kudosable" : "true", show cdp entry { * | entry-name [ protocol | version ]} Syntax Description Command Modes Privileged EXEC Command History Examples The following is sample output from the show cdp entry command with no limits. { }, }, LITHIUM.AjaxSupport.ComponentEvents.set({ ] "event" : "ProductMessageEdit", { This section lists the top 10 Cisco Meraki devices in the network, ranked by total network usage, along with the total number of unique clients that used the device. "actions" : [ }, "context" : "", This one, along with other basic port level statistics, are something I would like to see. "actions" : [ { } ] "actions" : [ "event" : "MessagesWidgetMessageEdit", "context" : "", "action" : "rerender" LITHIUM.InlineMessageReplyEditor({"openEditsSelector":".lia-inline-message-edit","ajaxFeebackSelector":"#inlinemessagereplyeditor_0 .lia-inline-ajax-feedback","collapseEvent":"LITHIUM:collapseInlineMessageEditor","confimationText":"You have other message editors open and your data inside of them might be lost. }, LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, '2Nx7zKIPxkljFawDyVWdfOensCuYFZprHYNuL_D4mF4. { "event" : "ProductAnswer", LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_10f452b179b055d","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_10f452b179b055d_0","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.usersearchfield:userexistsquery?t:ac=board-id/security/message-id/7046/thread-id/7046&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"G26YlnjMXlZ6vpSLPTgWV10jRwHzPCo8A6L6KQWRvkg. "action" : "rerender" "action" : "pulsate" "actions" : [ { "disableKudosForAnonUser" : "false", "actions" : [ ] Code is public and open source here: https://github.com/routetonull/getMerakiNeighbor Hope you find it useful. "action" : "rerender" ] This will tell you a port of the switch. }); "displayStyle" : "horizontal", "event" : "addThreadUserEmailSubscription", "context" : "", RouterOrSwitch (config-if)#no cdp enable. { } "context" : "", "actions" : [ "event" : "ProductAnswerComment", "actions" : [ }, "actions" : [ Technical Forums. "action" : "rerender" "actions" : [ "}); "context" : "", ], ', 'ajax'); Use show mac address-table address <MAC address>, where the <MAC address> is the one we found in the previous step. Are you sure you want to proceed? ] }, Show CDP Neighbors Use This command lists the Cisco devices that are connected to your current device. { "message" : "29619", } "event" : "RevokeSolutionAction", "parameters" : { Have wished for it dozens of times. "event" : "kudoEntity", The Cisco command show lldp neighbors is helpful for identifying adjacent switches; use this command to view and decode LLDP traffic: tcpdump -vn -s 1500 -i (interface) ether proto 0x88cc. "entity" : "29618", } ] { { "event" : "unapproveMessage", } "action" : "rerender" ] LITHIUM.SearchAutoCompleteToggle({"containerSelector":"#searchautocompletetoggle_10f452b179b055d","enableAutoCompleteSelector":".search-autocomplete-toggle-link","enableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:enableAutoComplete","disableAutoCompleteSelector":".lia-autocomplete-toggle-off","disableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:disableAutoComplete","autoCompleteSelector":".lia-autocomplete-input"}); }, } "context" : "", "truncateBodyRetainsHtml" : "false", "event" : "deleteMessage", { "action" : "rerender" "event" : "ProductMessageEdit", "actions" : [ "actions" : [ { https://dashboard.meraki.com/api_docs#list-lldp-and-cdp-information-for-a-device. LLDP vs CDP - Cisco Learning Network 15 lines) of information, one set for every neighbor - show cdp entry "name" = lists the same information . { ] "context" : "", { "action" : "pulsate" . Dell Networking systems support up to eight neighbors per interface. ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_7","feedbackSelector":".InfoMessage"}); { Here are the results of the command you provided that I ran against a Meraki switch being monitored: 1 devices discovered in 1.234 secs SNMP [2/0.02s]: Snmpget [2/0.02s] SQL [13/0.07s]: Select [11/0.05s] Delete [1/0.00s] Update [1/0.02s] RRD [0/0.00s]: laf January 27, 2022, 10:15pm #5 "action" : "rerender" "message" : "29387", } } }, { ] "action" : "rerender" }, { "actions" : [ { "event" : "expandMessage", "actions" : [ "actions" : [ show arp. { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lazyLoadScripts"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer_7","action":"lazyLoadScripts","feedbackSelector":"#inlineMessageReplyContainer_7","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:lazyloadscripts?t:ac=board-id/security/message-id/7046/thread-id/7046&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"Mz-Y3Fv70KfCijFlVb1LrC2bIGNyCpdY956yMjF3HxI. "actions" : [ "context" : "envParam:quiltName,product,contextId,contextUrl", The GUI has device inventory, which shows everything on every port, sorted by vendor. "event" : "MessagesWidgetEditAnswerForm", "context" : "", "revokeMode" : "true", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } } "event" : "ProductAnswer", "action" : "pulsate" Parameters <INTERFACE-ID> Specifies an interface. LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"threadeddetaildisplaymessageviewwrapper_2","componentSelector":"#threadeddetaildisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":29620,"confimationText":"You have other message editors open and your data inside of them might be lost. }, LITHIUM.MessageBodyDisplay('#bodyDisplay_0', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); } ] ] { "context" : "envParam:entity", "action" : "rerender" { { "quiltName" : "ForumMessage", }, "disallowZeroCount" : "false", ', 'ajax'); ] "}); ] } "context" : "", Make sure the switch supports PoE. } CDP is a Cisco proprietary protocol and will only detect Cisco products, although there are some vendors that do work with it. ] }, ","messageActionsSelector":"#messageActions_5","loaderSelector":"#loader","renderEvent":"LITHIUM:renderInlineMessageReply","expandedRepliesSelector":".lia-inline-message-reply-form-expanded","topicMessageSelector":".lia-forum-topic-message-gte-5","containerSelector":"#inlineMessageReplyContainer_5","layoutView":"threaded","replyButtonSelector":".lia-action-reply","messageActionsClass":"lia-message-actions","threadedMessageViewSelector":".lia-threaded-display-message-view-wrapper","lazyLoadScriptsEvent":"LITHIUM:lazyLoadScripts","isGteForumV5":true,"loaderEnabled":false,"useSimpleEditor":false,"isReplyButtonDisabled":false}); }, "context" : "", "actions" : [ "event" : "addMessageUserEmailSubscription", "action" : "rerender" "action" : "rerender" "action" : "rerender" }, "event" : "deleteMessage", ] { { "}); LITHIUM.lazyLoadComponent({"selectors":{"elementSelector":"#inlinemessagereplyeditor_0"},"events":{"lazyLoadComponentEvent":"LITHIUM:lazyLoadComponent"},"misc":{"isLazyLoadEnabled":true}}); "actions" : [ ] "actions" : [ }); The Meraki MS390 is the most powerful access switch in the Meraki portfolio which combines the simplicity of cloud-managed IT with the power of innovative Cisco switching technology. "action" : "rerender" { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_9","feedbackSelector":".InfoMessage"}); ] "event" : "AcceptSolutionAction", } "action" : "rerender" "action" : "rerender" "context" : "envParam:quiltName,product,contextId,contextUrl", "actions" : [ ] "actions" : [ "initiatorBinding" : true, "useSimpleView" : "false", "context" : "", "context" : "envParam:quiltName,product,contextId,contextUrl", Top Clients by Usage This section lists the top 10 clients on the network based on total usage (upload and download) during the time period. "entity" : "71084", LITHIUM.Components.renderInPlace('recommendations.widget.recommended-content-taplet', {"componentParams":"{\n \"mode\" : \"slim\",\n \"componentId\" : \"recommendations.widget.recommended-content-taplet\"\n}","componentId":"recommendations.widget.recommended-content-taplet"}, {"errorMessage":"An Unexpected Error has occurred. Description: This command simply shows the current time configured on the device in hours, minutes and seconds. LITHIUM.InlineMessageReplyContainer({"openEditsSelector":".lia-inline-message-edit","linearDisplayViewSelector":".lia-linear-display-message-view","renderEventParams":{"replyWrapperId":"replyWrapper_1","messageId":29618,"messageActionsId":"messageActions_1"},"threadedDetailDisplayViewSelector":".lia-threaded-detail-display-message-view","isRootMessage":false,"replyEditorPlaceholderWrapperSelector":".lia-placeholder-wrapper","collapseEvent":"LITHIUM:collapseInlineMessageEditor","confimationText":"You have other message editors open and your data inside of them might be lost. LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_8","menuItemsSelector":".lia-menu-dropdown-items"}}); "event" : "approveMessage", ] }); "actions" : [ "forceSearchRequestParameterForBlurbBuilder" : "false", [CONTEST CLOSED] Happy Valentines Day! LITHIUM.Loader.runJsAttached(); { } "context" : "", }); This is not something. ] Let's look at one of the switches that has had it's uplink moved to the MX. } "initiatorDataMatcher" : "data-lia-message-uid" LITHIUM.Auth.LOGIN_URL_TMPL = '/plugins/common/feature/saml/doauth/post?referer=https%3A%2F%2FREPLACE_TEXT'; "actions" : [ ], ] "action" : "rerender" } Enter the show cdp neighbor interface-name command to verify the name and PortID of a remote device match the network design. LITHIUM.InlineMessageReplyContainer({"openEditsSelector":".lia-inline-message-edit","linearDisplayViewSelector":".lia-linear-display-message-view","renderEventParams":{"replyWrapperId":"replyWrapper_7","messageId":99480,"messageActionsId":"messageActions_7"},"threadedDetailDisplayViewSelector":".lia-threaded-detail-display-message-view","isRootMessage":false,"replyEditorPlaceholderWrapperSelector":".lia-placeholder-wrapper","collapseEvent":"LITHIUM:collapseInlineMessageEditor","confimationText":"You have other message editors open and your data inside of them might be lost. "context" : "envParam:quiltName", Meraki CDP/LLDP neighbors via CLI (Python) Hi all, just sharing the new release of my Python script to get CDP/LLDP neighbors via CLI. HTH -VJ 0 Helpful Share Reply cajalat Beginner In response to vijayasankar } Both devices show up in the LLDP neighbors table as coming from the same ingress port. { "actions" : [ "event" : "MessagesWidgetAnswerForm", }, This one, along with other basic port level statistics, are something I would like to see. ","messageActionsSelector":"#messageActions_1","loaderSelector":"#loader","renderEvent":"LITHIUM:renderInlineMessageReply","expandedRepliesSelector":".lia-inline-message-reply-form-expanded","topicMessageSelector":".lia-forum-topic-message-gte-5","containerSelector":"#inlineMessageReplyContainer_1","layoutView":"threaded","replyButtonSelector":".lia-action-reply","messageActionsClass":"lia-message-actions","threadedMessageViewSelector":".lia-threaded-display-message-view-wrapper","lazyLoadScriptsEvent":"LITHIUM:lazyLoadScripts","isGteForumV5":true,"loaderEnabled":false,"useSimpleEditor":false,"isReplyButtonDisabled":false}); "context" : "", "truncateBodyRetainsHtml" : "false", "useCountToKudo" : "false", "}); { "messageViewOptions" : "1111110111111111111110111110100101011101", }, }, }, }, "actions" : [ { ', 'ajax'); { ] "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineMessageReply"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer_0","action":"renderInlineMessageReply","feedbackSelector":"#inlineMessageReplyContainer_0","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:renderinlinemessagereply?t:ac=board-id/security/message-id/7046/thread-id/7046&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"_XAxhSCMLQB_QhP739eiWwLCVddbgOblS5O-3om1CH4.

Wind River Shootout Explained, Two Truths And A Lie Ideas, Harrogate Advertiser Obituary, Articles S


Комментарии закрыты